PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi007897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 246aa    MW: 28040.5 Da    PI: 7.3968
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S37594170PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.2e-32151204255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt++LH++Fv+av+ LGG+e+AtPk+++elm+vk+Ltl+hvkSHLQ+YR+
  Psi007897 151 PRMRWTSTLHAHFVHAVKLLGGHERATPKSVMELMNVKDLTLTHVKSHLQMYRT 204
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.53E-16148204IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28149204IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23151204IPR006447Myb domain, plants
PfamPF002494.1E-7152203IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
EKQRQKNICA QGLMRLSGGP EDPRLIMSCL SGGETRKAIE DASSLGLVDS YYGHDFEVSV  60
NKEDYRCSDE FLRDNKTREA PFFRPYEGIL MNRVMTPNHP HSLSDSEDHF QGSSSHPKEI  120
HSCNPSPATI SDSHSCIKSR FMTKRRSMRA PRMRWTSTLH AHFVHAVKLL GGHERATPKS  180
VMELMNVKDL TLTHVKSHLQ MYRTVKGIDK SACPSGHDES EALGTFDGKY FEDFTENEIE  240
YCDRRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303435.21e-40hypothetical protein POPTR_0003s09490g
RefseqXP_002303436.21e-40hypothetical protein POPTR_0003s09490g
TrEMBLB9GZJ21e-40B9GZJ2_POPTR; Uncharacterized protein
TrEMBLB9GZJ11e-40B9GZJ1_POPTR; Uncharacterized protein
STRINGPOPTR_0003s09490.13e-40(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.24e-39G2-like family protein